PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013590819.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 320aa    MW: 37124.8 Da    PI: 8.8862
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013590819.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.78.7e-16103148147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+ +G+ +W++Ia+++  gR++k+c++rw++ 
   XP_013590819.1 103 RGHWRPAEDAKLKELVAVYGPQNWNLIAEKLH-GRSGKSCRLRWFNQ 148
                      899*****************************.***********996 PP

2Myb_DNA-binding59.76.5e-19155199147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r ++T+eE+e+l +a++++G++ W+ Iar ++ gRt++++k++w+ +
   XP_013590819.1 155 RRAFTEEEEERLMQAHNLYGNK-WAMIARLFP-GRTDNSVKNHWHVV 199
                      678*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.10898149IPR017930Myb domain
SuperFamilySSF466892.25E-29101196IPR009057Homeodomain-like
SMARTSM007171.7E-13102151IPR001005SANT/Myb domain
PfamPF002492.4E-15103148IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-27104156IPR009057Homeodomain-like
CDDcd001673.57E-12106147No hitNo description
PROSITE profilePS5129426.923150204IPR017930Myb domain
SMARTSM007172.4E-15154202IPR001005SANT/Myb domain
PfamPF002491.1E-15155198IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-21157203IPR009057Homeodomain-like
CDDcd001677.92E-12157200No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MGMEIAYTNV SFPSITPHFP SSSHPLTNNN NIFMSKDHHR RMDQIAYFSL NVNNDQHKGH  60
YYHASHGEEE MKNPNRCNCS TSSKKERRDC GSCRHSLKAS VSRGHWRPAE DAKLKELVAV  120
YGPQNWNLIA EKLHGRSGKS CRLRWFNQLD PRINRRAFTE EEEERLMQAH NLYGNKWAMI  180
ARLFPGRTDN SVKNHWHVVM ARKFREQSSV YPRRKTMITH KPLVNPNAHS CNDFEPTRSD  240
LIHLVGNDQS HLMLPIPCFT GYDHGVFENQ MMIDDYSTRT REVATTFGDS NQTGKCEMLD  300
ESMNEKKKPH FFDFLGLGTV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-321012045108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893530.0AC189353.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB043L15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013590819.10.0PREDICTED: transcription factor MYB21-like
TrEMBLA0A0D3CZA70.0A0A0D3CZA7_BRAOL; Uncharacterized protein
STRINGBra004394.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.11e-148myb domain protein 105